PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G178300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 258aa    MW: 28881.2 Da    PI: 5.9053
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G178300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-161461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT+eEd++l+  +  +G  +W+++++  g+ R++k+c++rw +yl
  Sobic.007G178300.1.p 14 RGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                          89******************************99************97 PP

2Myb_DNA-binding53.65e-1770111447
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            +t E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  Sobic.007G178300.1.p  70 LSTAEEQLVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                           5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-22562IPR009057Homeodomain-like
PROSITE profilePS5129414.274961IPR017930Myb domain
SuperFamilySSF466894.12E-2711108IPR009057Homeodomain-like
SMARTSM007174.2E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001674.64E-101661No hitNo description
PROSITE profilePS5129427.18162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2563117IPR009057Homeodomain-like
SMARTSM007177.9E-1566114IPR001005SANT/Myb domain
CDDcd001672.27E-1171112No hitNo description
PfamPF002498.4E-1571111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRQPCCDKQ GVKRGPWTAE EDKKLISFIL THGRCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL STAEEQLVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
LDPATHQPLS NSNATSSQST VTDESAKSSD FREELSLKDD SHREVPLSTD SSEQSSWPES  180
STNGCDQDPE LLVNWPDLLM DEPWLNFMSS NDELGNVEGA LPWDGTTDWL LDYQDFGMCS  240
SNSVDNSTFH ASNGSNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0684100.0BT068410.1 Zea mays full-length cDNA clone ZM_BFb0166A10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444623.11e-178hypothetical protein SORBIDRAFT_07g024970
SwissprotQ50EX65e-89ODO1_PETHY; Protein ODORANT1
TrEMBLC5YH431e-178C5YH43_SORBI; Putative uncharacterized protein Sb07g024970
STRINGSb07g024970.11e-177(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.12e-84myb domain protein 42